PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G03040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 247aa    MW: 28768.4 Da    PI: 7.0863
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G03040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.1e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed ll ++v+q+G g+W+++a+  g++R++k+c++rw +yl
  ORUFI03G03040.1 15 KGPWTALEDRLLTEYVQQHGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 62
                     79********************************************97 PP

2Myb_DNA-binding53.17.3e-1768112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+  +++++++lG++ W++Iar+++ gRt++++k++w+++
  ORUFI03G03040.1  68 RGKITPDEETVILQLHAMLGNR-WSAIARCLP-GRTDNEIKNYWRTH 112
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8421062IPR017930Myb domain
SuperFamilySSF466891.04E-3012109IPR009057Homeodomain-like
SMARTSM007175.8E-151464IPR001005SANT/Myb domain
PfamPF002499.6E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-231669IPR009057Homeodomain-like
CDDcd001672.24E-101762No hitNo description
PROSITE profilePS5129423.40363117IPR017930Myb domain
SMARTSM007179.9E-1667115IPR001005SANT/Myb domain
PfamPF002499.2E-1568112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2470115IPR009057Homeodomain-like
CDDcd001672.41E-1072113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MDEIRSLMLQ QGWRKGPWTA LEDRLLTEYV QQHGEGSWNS VAKLTGLRRS GKSCRLRWVN  60
YLRPDLKRGK ITPDEETVIL QLHAMLGNRW SAIARCLPGR TDNEIKNYWR THFKKARPSR  120
RARAQLLHQY QLQQQQQHRQ YLHSLNLLQQ QQQQLQQQQQ QQQQQMMLLQ EQEQQSPQEE  180
AADDSMVMMM MNDLQSKERC CTAVSVVPDD CVLPADDDAI WDSLWRLVDG DGSCGEGSSG  240
GEYWATS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271511527126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1221490.0AC122149.2 Oryza sativa Japonica Group chromosome 3 clone OSJNBa0083D24, complete sequence.
GenBankAC1376970.0AC137697.2 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0081A17, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630196.10.0PREDICTED: transcription factor WER
TrEMBLA0A0E0NPI00.0A0A0E0NPI0_ORYRU; Uncharacterized protein
TrEMBLQ10RX90.0Q10RX9_ORYSJ; Myb-like DNA-binding domain containing protein
STRINGLOC_Os03g04900.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.17e-62myb domain protein 305